A5029244263- Cancer-related molecular mechanisms research
- Circular RNAs in diseases
- RNA modifications and cancer
- Fuel Cells and Related Materials
- Metalloenzymes and iron-sulfur proteins
- RNA and protein synthesis mechanisms
- Shoulder and Clavicle Injuries
- Advanced biosensing and bioanalysis techniques
- Shoulder Injury and Treatment
- Cancer, Hypoxia, and Metabolism
- Antimicrobial Peptides and Activities
- COVID-19 and Mental Health
- Trauma Management and Diagnosis
- Mitochondrial Function and Pathology
- Marine and coastal plant biology
- Tryptophan and brain disorders
- Nitric Oxide and Endothelin Effects
- Cancer, Stress, Anesthesia, and Immune Response
- Tuberculosis Research and Epidemiology
- Fungal Biology and Applications
- Mental Health Research Topics
- Polysaccharides and Plant Cell Walls
- Bacterial Genetics and Biotechnology
- Stress Responses and Cortisol
- RNA Interference and Gene Delivery
Huazhong University of Science and Technology
2025
Tongji Hospital
2025
Fujian Agriculture and Forestry University
2024-2025
Second Affiliated Hospital of Xi'an Jiaotong University
2020-2025
Nanyang Normal University
2021-2025
Nantong University
2015-2024
Creative Commons
2024
Affiliated Hospital of Nantong University
2018-2024
Zero to Three
2024
Shanghai Jiao Tong University
2014-2023
Abstract Immunotherapy has revolutionized cancer treatment, but its efficacy is severely hindered by the lack of effective predictors. Herein, we developed a homogeneous, low‐volume, efficient, and sensitive exosomal programmed death‐ligand 1 (PD‐L1, type transmembrane protein) quantitation method for diagnosis immunotherapy response prediction (HOLMES‐Exo PD‐L1 ). The combines newly evolved aptamer that efficiently binds to with less hindrance antigen glycosylation than antibody,...
Antimicrobial peptides (AMPs) play pivotal roles in the innate defense of vertebrates. A novel AMP (cathelicidin-PY) has been identified from skin secretions frog Paa yunnanensis . Cathelicidin-PY an amino acid sequence RKCNFLCKLKEKLRTVITSHIDKVLRPQG. Nuclear magnetic resonance (NMR) spectroscopy analysis revealed that cathelicidin-PY adopts a tertiary structure with mostly positively charged surface containing helix (Thr15-Ser19). It possesses strong antimicrobial activity, low hemolytic...
Dendrimer-like DNA nanostructures have attractive properties such as mechanical stability, highly branched nanostructure, customized sizes, and biocompatibility. In this study, we construct programmable dendrimeric nanoparticles efficient vehicles to deliver immunostimulatory cytosine-phosphate-guanosine (CpG) sequences for activation of the immune response. dendrimers decorated with CpG-containing hairpin-loops triggered stronger response characterized by pro-inflammatory cytokines...
To understand the diversity, taxonomy and antagonistic potential of rice-associated bacteria, to discover new bacteria for biocontrol rice foliar pathogens.Amplified ribosomal DNA restriction analysis (ARDRA), BOX-PCR 16S rRNA gene sequence were used identify diversity 203 bacteria. Eleven test their biological control blast in a natural field experiment. different genera encountered five divisions, including Bacilli, Alphaproteobacteria, Betaproteobacteria, Gammaproteobacteria Deinococci....
In this study, polysaccharides from Angelica sinensis were extracted using the ultrasound-assisted extraction method. Based on results of single factor experiments and orthogonal tests, three independent variables—water/raw material ratio, ultrasound time, power—were selected for investigation. Then, we used response surface methodology to optimize conditions. The experimental data fitted a quadratic equation multiple regression analysis, optimal conditions as follows: water/raw 43.31 mL/g;...
DNA nanostructures are promising biomaterials capable of arranging multiple functional components with nanometer precision. Here, a double-bundle tetrahedron is rationally designed to integrate antisense oligonucleotides silencing proto-oncogene c-raf and nuclear targeting peptides. The functionalized can be internalized by A549 cells assists the delivery toward nucleus increase chance downregulate target mRNA in cytoplasm. Antisense strands released from response intracellular reducing...
Proteins were extracted from perilla (Perilla frutescens L. Britton) seed by-products and hydrolyzed with an alkaline protease. Antioxidant peptides purified the hydrolysate by size-exclusion chromatography RP-HPLC. Two strong antioxidant activity identified as Tyr-Leu (YL) Phe-Tyr (FY) molecular mass of 294.33 Da 328.33 Da, respectively. Synthesized YL FY efficiently quenched free radicals (DPPH, ABTS hydroxyl radicals) showed high oxygen radical absorbance capacity. The two also inhibited...
Biogenesis of iron–sulfur clusters requires a concerted delivery iron and sulfur to target proteins. It is now clear that in derived from L-cysteine via cysteine desulfurases. However, the specific donor for cluster assembly still remains elusive. Previous studies showed IscA, member machinery Escherichia coli, novel iron-binding protein, iron-bound IscA can provide proposed scaffold IscU vitro. genetic have indicated not essential cell growth E. coli. In present paper, we report SufA, an...
The nitric oxide (NO) cytotoxicity has been well documented in bacteria and mammalian cells. However, the underlying mechanism is still not fully understood. Here we report that transient NO exposure effectively inhibits cell growth of Escherichia coli minimal medium under anaerobic conditions restored when NO-exposed cells are either supplemented with branched-chain amino acids (BCAA) anaerobically or returned to aerobic conditions. enzyme activity measurements show dihydroxyacid...
Pyrazinamide (PZA) is a first-line drug for tuberculosis (TB) treatment and responsible shortening the duration of TB therapy. The mode action PZA remains elusive. RpsA, ribosomal protein S1 Mycobacterium (Mtb), was recently identified as target based on its binding activity to pyrazinoic acid (POA), active form PZA. POA RpsA led inhibition trans-translation. However, nature RpsA-POA interaction unknown. Key questions include why exhibits an exquisite specificity Mtb how mutations confer...
Abstract Immunotherapy has revolutionized cancer treatment, but its efficacy is severely hindered by the lack of effective predictors. Herein, we developed a homogeneous, low‐volume, efficient, and sensitive exosomal programmed death‐ligand 1 (PD‐L1, type transmembrane protein) quantitation method for diagnosis immunotherapy response prediction (HOLMES‐Exo PD‐L1 ). The combines newly evolved aptamer that efficiently binds to with less hindrance antigen glycosylation than antibody,...
Abstract Background MicroRNAs (miRNAs) function as potential diagnostic biomarkers in various cancers. This study aimed to evaluate the roles of miR‐205‐5p lung cancer progression and diagnosis. Materials Methods MiR‐205‐5p was detected by quantitative real‐time PCR. The effect on cell proliferation metastasis estimated MTT flow cytometry. expression TP53INP1 related genes analyzed immunoblotting. value using receiver operating characteristic (ROC) curve analysis, sensitivity, specificity....
Abstract The coronavirus disease 2019 (COVID-19) pandemic has a disproportionate impact on vulnerable subpopulations, including those with severe mental illness (SMI). This study examined the one-year prevalence of suicidal ideation (SI), suicide plans (SP), and attempts (SA) in bipolar disorder (BD) schizophrenia (SCZ) patients during pandemic. Prevalence rates were compared between two disorders associated factors examined. A survey was conducted six tertiary psychiatric hospitals units....
Increasing evidence suggests that sulfur in ubiquitous iron-sulfur clusters is derived from l-cysteine via cysteine desulfurases. In <i>Escherichia coli</i>, the major desulfurase activity for biogenesis of has been attributed to IscS. The gene encodes IscS a member an operon <i>iscSUA</i>, which also two highly conserved proteins: IscU and IscA. Previous studies suggested both IscA may act as cluster assembly scaffold proteins. However, recent indicated iron-binding protein can provide iron...
Although the NO (nitric oxide)-mediated modification of iron-sulfur proteins has been well-documented in bacteria and mammalian cells, specific reactivity with still remains elusive. In present study, we report first kinetic characterization reaction between clusters protein using Escherichia coli IlvD (dihydroxyacid dehydratase) [4Fe-4S] cluster as an example. Combining a sensitive electrode EPR (electron paramagnetic resonance) spectroscopy enzyme activity assay, demonstrate that is...
As of February 2017, approximately 7639 amphibian species have been described in the AmphibiaWeb database. However, only 20 cathelicidin-like antimicrobial peptides identified to date from 10 species. Half these were genome sequences and not yet functionally characterized. In this study, a novel peptide designated cathelicidin-PP was purified skin tree frog Polypedates puerensis. Cathelicidin-PP is 32 residue sequence ASENGKCNLLCLVKKKLRAVGNVIKTVVGKIA. Circular dichroism spectroscopy...