A diuretic hormone of unusual structure was isolated from extracts whole heads the mealworm Tenebrio molitor. The is a 37-aa peptide 4371 Da, with sequence SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN. This increases cAMP production in Malpighian tubules T. amino acid reveals that this member family sauvagine/corticotropin-releasing factor/urotensin I-related insect hormones. C-terminal quite different other members family, which have hydrophobic C terminus (isoleucinamide or valinamide). When...

Urban Blue Spaces (UBS) have been found to be beneficial people’s mental health. Yet, the empirical evidence for how and why different types of urban blue spaces could promote residents’ health is still limited. Accordingly, 164 observation samples were collected this experiment relating restorative perception environmental exposure. The effects two exposure behaviors (15 min viewing 15 walking) on psychological recovery in three settings (Urban River, Canal, Lake) investigated a field...

Understanding the changes in land use and cover (LULC) national parks their corresponding ecosystem service value (ESV) shifts are crucial for shaping future management policies directions. However, comprehensive analyses this research area that integrate tourism development perspectives lacking. Therefore, interdisciplinary study considers Akan-Mashu National Park Japan as a case study. Using remote sensing data, LULC maps past 10 years were generated using Google Earth Engine. The benefit...

Understanding the changes in land use and cover (LULC) national parks their corresponding ecosystem service value (ESV) shifts is crucial for shaping future management policies directions. However, comprehensive analyses this research area that integrate tourism development perspectives are lacking. Therefore, interdisciplinary study considers Akan-Mashu National Park Japan as a case study. Using remote sensing data, LULC maps past 10 years were generated using Google Earth Engine. The...

Green cultural heritage is an important form of natural space in cities. Only a few studies have conducted restorative historical environment as most focused on environments. Moreover, ecosystem services (CESs) addressed heritage. Based onsite questionnaire distributed to green users (N = 64) Hamarikyu Garden, this paper explores the value CESs site and relationship between values perceived attention restoration/stress reduction. A multiple linear regression analysis simple analyses were...

People’s reduced connection with nature has led to many health problems. In the NBS framework, urban wildscapes (UWSs) are considered an important solution. They can contribute improving of residents and ecosystems within city. However, overly wild green spaces may also be offensive residents. It is necessary understand public’s acceptance UWSs. Current studies on UWSs have used vague terms generalize “wildness degree”. this study, we attempted quantify degree wildness using plant height...

Tourism behaviour in cultural heritage gardens presents opportunities and challenges for sustainable management. Understanding visitor perceptions assessments of visual resources are great interest to site managers. Using a case study the Kairakuen Garden Japan, we collected images (N = 430) geographic data tourist photos garden through visitor-employed photography technology analyse what hotspots attract tourists take photos. We also evaluated attributes photo using questionnaire. The...

Community streets play a crucial role in promoting healthy aging and encouraging active behaviors among older adults. This study focuses on two types of activities adults: walking social interaction. We explored the relationship between physical environmental factors different activity using multiple linear regression model. Eye-level green visibility (GSVN) was used to represent diversity facilities (DFN), while betweenness (ABN) accounted for mixed degree functions (PNi), enhancing model...

Informal green spaces (IGSs) play an essential role in enhancing urban well-being by offering restorative environments, yet the impact of visitor behaviors on perceived restorativeness (PR) remains underexplored. This study investigates how different spatio-temporal influence PR IGS, providing planners with actionable insights to optimize these for better user experiences. Using a visitor-employed photography (VEP) survey and post-visit assessments, K-means clustering was applied identify...

Informal green spaces (IGSs) are vital yet under-researched urban areas that enhance biodiversity, provide ecosystem services, and improve the well-being of residents. However, lack a consistent definition comprehensive understanding their multifunctional roles has hindered effective integration into planning. The current literature review aimed to clarify concept IGSs, analyze research trends, identify further areas. Using combined bibliometric systematic analysis approach, 150 articles...

The rapid expansion of digital commerce, particularly same-day-delivery and next-day-delivery online shopping, is transforming daily life community dynamics in urban settings. This study explores how these shopping behaviors impact the sense by mediating various social activities at both individual levels. Using an survey design, this analyzes roles different types interactions, including informal gatherings organized events, shaping a community. findings reveal that while unplanned,...

Abstract The impact of COVID-19 on university students’ utilization campus’ green spaces and its need in the post-epidemic era was studied this research. Data were collected from Chinese Japanese students using an online questionnaire. findings show that induced campus lockdown affected motivation to go school, reduced time spent campus, school frequency. encouraged explore despite their inability enter campus. Arguably, has significantly influenced usage pattern spaces. In post-pandemic...