A5081591789- Antimicrobial Peptides and Activities
- Insect Utilization and Effects
- Wound Healing and Treatments
- Blood Coagulation and Thrombosis Mechanisms
- Protein Hydrolysis and Bioactive Peptides
- Pancreatitis Pathology and Treatment
- Healthcare and Venom Research
- Immune Response and Inflammation
- Aquaculture disease management and microbiota
- Protease and Inhibitor Mechanisms
- S100 Proteins and Annexins
- Sirtuins and Resveratrol in Medicine
- Venomous Animal Envenomation and Studies
- Cell Adhesion Molecules Research
- Neuropeptides and Animal Physiology
- Ion channel regulation and function
- Neurobiology and Insect Physiology Research
- Silk-based biomaterials and applications
Southern Medical University
2022-2025
Parkinson's disease (PD) is a neurodegenerative condition that results in dyskinesia, with oxidative stress playing pivotal role its progression. Antioxidant peptides may thus present therapeutic potential for PD. In this study, novel cathelicidin peptide (Cath-KP; GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV) was identified from the skin of Asiatic painted frog (
Amphibian skin is acknowledged to contain an antioxidant system composed of various gene-encoded peptides, which exert significant effects on host defense. Nevertheless, recognition such peptides in its infancy so far. Here, we reported the properties and underlying mechanism a new peptide, brevinin-1FL, identified from Fejervarya limnocharis frog skin. The cDNA sequence encoding brevinin-1FL was successfully cloned total F. showed 222 bp. deduced mature peptide FWERCSRWLLN. Functional...
Acute pancreatitis (AP) is a serious inflammatory disorder and still lacks effective therapy globally. In this study, novel Ranacyclin peptide, Ranacin, was identified from the skin of Pelophylax nigromaculatus frog. Ranacin adopted compact β-hairpin conformation with disulfide bond (Cys5-Cys15). also demonstrated effectively to inhibit trypsin have anticoagulant antioxidant activities in vitro. Furthermore, severity significantly alleviated l-Arg-induced AP mice after treatment Ranacin....
Wound healing is a complex process and remains considerable challenge in clinical trials due to the lack of ideal therapeutic drugs. Here, new peptide TK-HR identified from skin frog Hoplobatrachus rugulosus was tested for its ability heal cutaneous wounds mice. Topical application at doses 50–200 μg/mL significantly accelerated wound closure without causing any adverse effects animals. In vitro vivo investigations proved regulatory role on neutrophils, macrophages, keratinocytes, vein...