Xiaowen Huang

ORCID: 0000-0003-3939-293X
Publications
Citations
Views
---
Saved
---
About
Contact & Profiles
Research Areas
  • Fungal Infections and Studies
  • Antifungal resistance and susceptibility
  • Cervical Cancer and HPV Research
  • Invertebrate Immune Response Mechanisms
  • Antimicrobial Peptides and Activities
  • Acne and Rosacea Treatments and Effects
  • Studies on Chitinases and Chitosanases
  • Autoimmune Bullous Skin Diseases
  • Dermatology and Skin Diseases
  • Wound Healing and Treatments
  • Photodynamic Therapy Research Studies
  • Genetics, Aging, and Longevity in Model Organisms
  • Herpesvirus Infections and Treatments
  • Plant Pathogens and Fungal Diseases
  • Psoriasis: Treatment and Pathogenesis
  • Liver Disease and Transplantation
  • Folate and B Vitamins Research
  • Mesenchymal stem cell research
  • Urticaria and Related Conditions
  • Nanoparticles: synthesis and applications
  • Immunodeficiency and Autoimmune Disorders
  • Viral-associated cancers and disorders
  • Nonmelanoma Skin Cancer Studies
  • Nail Diseases and Treatments
  • Systemic Lupus Erythematosus Research

Nanfang Hospital
2017-2025

Southern Medical University
2017-2025

University of Hong Kong
2025

PLA Academy of Military Science
2022-2024

Chinese PLA General Hospital
2024

Ocean University of China
2021-2024

Zhejiang Ocean University
2023

First Affiliated Hospital of Henan University
2023

Zhengzhou University
2019-2022

Guangdong University Of Finances and Economics
2022

An efficient use of energy is the pre-condition for economic development. But excessive fossil fuel harms environment. As renewable emits no or low greenhouse gases, more countries are trying to increase energies from sources. At same time, matter developed developing, nations have maintain growth. By collecting SCI/SSCI indexed peer-reviewed journal articles, this article systematically reviews consumption nexus and A total 46 articles been reviewed following PRISMA guidelines 2010 2021....

10.3389/fenvs.2022.878394 article EN cc-by Frontiers in Environmental Science 2022-04-29

Significance There is a critical lack of therapeutic agents to treat infections caused by nongrowing persister forms methicillin-resistant Staphylococcus aureus (MRSA). Although membrane-disrupting can kill cells, their potential has been mostly overlooked because low selectivity for bacterial versus mammalian membranes. We report that the clinically approved anthelmintic drug bithionol kills MRSA persisters disrupting membrane lipid bilayers at concentrations exhibit levels toxicity cells....

10.1073/pnas.1904700116 article EN Proceedings of the National Academy of Sciences 2019-07-29

This paper measures the green energy consumption levels of 30 provinces and 221 cities in China from 2009 to 2019 by using entropy method comprehensive evaluation model. The natural breakpoint is applied divide data into three intervals corresponding low-level interval, medium level high-level interval explore spatial distribution pattern levels. Secondly, a difference-in-difference model built assess effect establishment new demonstration on significantly contributed improving consumption,...

10.1016/j.egyr.2022.06.009 article EN cc-by Energy Reports 2022-06-17

Abstract Triggering receptor expressed on myeloid cells 2 ( TREM ‐2) is a cell surface abundantly lineage such as macrophages and dendritic cells. It reported that ‐2 functions an inflammatory inhibitor in However, the role of bacterial killing remains unclear. This study explored eradication Pseudomonas aeruginosa PA ), Gram‐negative bacterium which causes various opportunistic infections. Phagocytosis assay assessed by flow cytometry suggested TREM‐2 was not involved uptake macrophages,...

10.1111/sji.12148 article EN Scandinavian Journal of Immunology 2014-01-02

Purpose: Zinc oxide nanoparticles (ZnO-NPs) have exerted antimicrobial properties. However, there is insufficient evaluation regarding the in vivo antifungal activity of ZnO-NPs. This study aimed to investigate efficacy and mechanism ZnO-NPs controlling Candida albicans invertebrate Galleria mellonella. Methods:Galleria mellonella larvae were injected with different doses determine their toxicity. Non-toxic chosen for prophylactic injection G. followed by C. infection. Then direct vitro...

10.3389/fmicb.2021.766138 article EN cc-by Frontiers in Microbiology 2021-12-10

Abstract Dysregulation of adipose tissue (AT) homeostasis in obesity contributes to metabolic stress and disorders. Here, we identified that Coiled‐coil‐helix‐coiled‐coil‐helix domain containing 10 (Chchd10) is a novel regulator AT remodeling upon excess energy intake. Chchd10 significantly reduced the white (WAT) mice response high‐fat diet (HFD) feeding. AT‐Chchd10 deficiency accelerates adipogenesis predominantly subcutaneous store short‐term HFD feeding while upregulates glutathione...

10.1002/advs.202408763 article EN cc-by Advanced Science 2025-02-22

10.1080/03610918.2025.2473444 article EN Communications in Statistics - Simulation and Computation 2025-03-18

Lipolysis in white adipose tissue (WAT) provides fatty acids as energy substrates for thermogenesis to increase expenditure. Syndecan-4 (Sdc4) is a transmembrane proteoglycan bearing heparan sulfate chains. Although single nucleotide polymorphisms (SNPs) of the Sdc4 gene have been identified linking metabolic syndromes, its specific function remains obscure. Here, we show that serves regulator lipid metabolism and adaptive thermogenesis. expression shedding are elevated WAT diet-induced...

10.1016/j.molmet.2025.102133 article EN cc-by Molecular Metabolism 2025-04-01

Abstract Human papillomavirus (HPV) infection poses a significant threat to public health worldwide. Targeting the function of HPV E6 and E7 proteins activating host immune response against these represent promising therapeutic strategies for combating HPV-related diseases. Consequently, efficient production soluble, high-purity is crucial studies. In this context, we selected pMCSG19 protein expression vector Escherichia coli produce soluble MBP-His 6 tagged HPV11/16 E6/E7 proteins,...

10.1186/s12985-023-02281-y article EN cc-by Virology Journal 2024-01-05

Penicillium marneffei, one of the most important thermal dimorphic fungi, is a severe threat to life immunocompromised patients. However, pathogenic mechanisms P. marneffei remain largely unknown. In this work, we developed model host by using nematode Caenorhabditis elegans investigate virulence marneffei. Using two clinical isolate strains 570 and 486, revealed that in both liquid solid media, ingestion live was lethal C. (P<0.001). Meanwhile, our results showed strain 570, which can...

10.1371/journal.pone.0108764 article EN cc-by PLoS ONE 2014-09-30

Osthole is a natural coumarin that exhibits wide biological and pharmacological activities such as neuroprotective, osteogenic, immunomodulation, antitumor, anti-inflammatory effects. In this study, we investigated the antifungal effects of osthole in vitro A checkerboard microdilution assay showed has significant synergistic effect with fluconazole against fluconazole-resistant Candida albicans Similar results were obtained from growth curve assay. Meanwhile, XTT reduction demonstrated...

10.1128/aac.00436-17 article EN Antimicrobial Agents and Chemotherapy 2017-06-13

Sporothrix globosa is a thermo-dimorphic fungus belonging to pathogenic clade that also includes schenckii, which causes human and animal sporotrichosis. Here, we present the first genome assemblies of two S. strains providing data for future comparative genomic studies in species.

10.1093/gbe/evw230 article EN cc-by-nc Genome Biology and Evolution 2016-09-15

Summary P enicillium marneffei , a dimorphic fungus that can cause penicilliosis marneffei, is endemic in Southeast Asia. The only known hosts of . are humans and bamboo rats. aim our study was to explore the distribution rats, their associated environment non‐rat‐associated environments. Totally, 270 samples were collected Guangdong province C hina 2012; prevalence much higher from surrounding areas burrows (8.2%) than obtained sites (2%) or artificial farms rats (0%). There no difference...

10.1111/1751-7915.12275 article EN cc-by Microbial Biotechnology 2015-03-30

Evidence from previous epidemiological studies on the effect of physical activity risk Alzheimer's disease (AD) is conflicting. We performed a two-sample Mendelian randomization analysis to verify whether causally associated with AD. This study used (MR) estimate association between (including overall activity, sedentary behavior, walking, and moderate-intensity activity) Genetic instruments for were obtained published genome-wide (GWAS) including 91,105 individuals UK Biobank. Summary-level...

10.1038/s41598-022-17207-x article EN cc-by Scientific Reports 2022-07-28

Parkinson's disease (PD) is a neurodegenerative condition that results in dyskinesia, with oxidative stress playing pivotal role its progression. Antioxidant peptides may thus present therapeutic potential for PD. In this study, novel cathelicidin peptide (Cath-KP; GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV) was identified from the skin of Asiatic painted frog (

10.24272/j.issn.2095-8137.2023.101 article EN 动物学研究 2023-09-05

Abstract Background New therapeutics are urgently needed for infectious diseases, especially the fungal infection like Fonsecaea monophora . Photodynamic therapy has been showing antimicrobial activity on some pathogens. The combination of medicines and photodynamic (PDT) might be a practical approach. However, whether treatment PDT could do benefits to host immunity remains poorly documented. Results In this study, Galleria mellonella larvae were employed as model organism evaluate PDT,...

10.1186/s12866-020-01882-9 article EN cc-by BMC Microbiology 2020-07-06

Background and Aim Acute-on-chronic liver failure (ACLF) has a high mortality rate. The role of granulocyte colony-stimulating factor (G-CSF) in ACLF remains controversial. Monocytes/macrophages are core immune cells, which involved the initiation progression failure; however, effect G-CSF on monocytes/macrophages is unclear. study aimed to verify clinical efficacy explore it monocytes hepatitis B virus (HBV)-related (HBV-ACLF) paitents. Methods We performed large randomized controlled trial...

10.3389/fimmu.2022.885829 article EN cc-by Frontiers in Immunology 2022-05-16
Coming Soon ...