- Plant-Microbe Interactions and Immunity
- Legume Nitrogen Fixing Symbiosis
- Nanoparticles: synthesis and applications
- Synthesis and biological activity
- Mycorrhizal Fungi and Plant Interactions
- Plant Micronutrient Interactions and Effects
- Synthesis and Characterization of Heterocyclic Compounds
- Synthesis and Biological Evaluation
- Biofuel production and bioconversion
- Phytase and its Applications
- Plant tissue culture and regeneration
- Crop Yield and Soil Fertility
- Agricultural Science and Fertilization
- Biochemical and Structural Characterization
- Enzyme-mediated dye degradation
- Agriculture and Rural Development Research
- Probiotics and Fermented Foods
- Agroforestry and silvopastoral systems
- Inflammasome and immune disorders
- Antimicrobial Peptides and Activities
- Graphene and Nanomaterials Applications
- Copper-based nanomaterials and applications
- Nematode management and characterization studies
- Anaerobic Digestion and Biogas Production
- Microbial Metabolism and Applications
Mohanlal Sukhadia University
2023-2025
Maharana Pratap University of Agriculture and Technology
2019-2023
G.S. Science, Arts And Commerce College
2022-2023
Mewar University
2020-2022
Zinc oxide (ZnO) nanoparticles have attracted significant interest due to their vast applications. However, green synthesis of ZnO is a challenge, and therefore, here we report zinc tolerant bacteria assisted microbial nanoparticles. Furthermore, the effective antimicrobial potential photocatalytic dye degradation capabilities these are also evaluated. The characterized using range physicochemical characterization techniques confirming nanoscale size, uniformspherical shape, high negative...
High food demand for the world's teeming population necessitates intensification of crop production in modern agriculture, which requires extensive use synthetic fertilizers higher yield. The excessive chemical fertilizers, despite high nutrients contents and ability to grow crops faster, discovered be dangerous health environment besides polluting groundwater atmosphere future. alternative these, biofertilizers arose today due their attributes towards eco-friendly, cost-effective, easy...
Abstract The increasing heavy metal contamination in agricultural soils has become a serious concern across the globe. present study envisages developing microbial inoculant approach for agriculture Zn contaminated soils. Potential zinc tolerant bacteria (ZTB) were isolated from (Zn) of southern Rajasthan, India. Isolates further screened based on their efficiency towards tolerance and plant growth promoting activities. Four strains viz . ZTB15, ZTB24, ZTB28 ZTB29 exhibited high degree to up...
Garlic is an important spice crop used for flavoring food and has a long history of use in traditional medicine. However, black mold common fungal disease affecting garlic, which was caused by Aspergillus infection. This significantly impacts both the production quality garlic. Therefore, this study aimed to evaluate antifungal activity novel green-synthesized zinc oxide nanoparticles (ZnO-NPs) against diseases An environmentally friendly green synthesis technique produce ZnO-NPs using...
Methicillin-Resistant Staphylococcus aureus (MRSA), a pathogenic bacterium that causes life-threatening outbreaks such as community-onset and nosocomial infections emerging 'superbug'. Time motion study of its virulent property developed resistance against most the antibiotics Vancomycin. Thereby, to curb this problem entails development new therapeutic agents. Plant-derived antimicrobial agents have recently piqued people's interest, so in research, 186 flavonoids compound selected unmask...
In the present study, 24 Azotobacter strains were isolated from soils of different areas southern Rajasthan and characterized at biochemical, functional, molecular levels. The gram negative cyst forming when viewed under microscope. These also screened for their plant growth promoting activities ability these isolates to survive abiotic stress conditions viz. salt, pH, temperature, drought stress. All showed IAA, siderophore, HCN, ammonia production, whereas seven phosphate solubilization....
This research aims to find out whether the 1, 2, 4-triazine and its derivatives have antifungal effects can protect humans from infection with Candida albicans. Molecular docking molecular dynamic simulation are widely used in modern drug design target a particular protein ligand. We interested using dynamics modeling investigate interaction between of enzyme Lanosterol 14-demethylase (CYP51) The inhibition albicans CYP51 is main goal our research. been docked enzyme, which involved...
The present research was conducted to characterize the indigenous plant growth promoting (PGP) Azotobacter strains isolated from root interface of semi-arid regions Rajasthan (India) and study their potential be used as bio-fertilizers. A total 172 were isolated, purified based on morphological test i.e. gram staining, pigmentation, cyst formation, fluorescence etc, broadly classified Azotobacter. Further secluded examined for biochemical analysis characters. All isolates showed different...
Two proinflammatory cytokines, IL17A and IL18, are observed to be elevated in the serum of gout patients they play a crucial role development worsening inflammation, which has severe effects. In present study, we have combined molecular docking, dynamics studies MM-PBSA analysis study effectiveness ethoxy phthalimide pyrazole derivatives (series 3a 3e) as potential inhibitors against cytokines IL18 druggable targets. The binding energy docked series ranges from −13.5 −10.0 kcal/mol...
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, its efficacy in controlling bacterial wilt (BW) disease tomato ( Solanum lycopersicum ) caused by Ralstonia solanacearum ....
Substituted ethoxy phthalimide pyrazole derivatives (
SGK1 (Serum and Glucocorticoid Regulated Kinase 1), a serine/threonine kinase that is activated by various stimuli, including serum glucocorticoids. It controls inflammation, apoptosis, hormone release, neuro-excitability cell proliferation, all of which play an important role in cancer progression metastasis. was recently proposed as potential drug target for cancer, diabetes, neurodegenerative diseases. In this study, molecular docking, physiochemical, toxicological properties dynamic...
Inoculation of important microbial strains in a modern intensive crop production is critical step for the improvement hybrid production. This study evaluated impact NPK consortia biofertilizer (NPK CB) and mineral fertilizer on growth yield two maize (Zea mays L.) hybrids at Mewar University research farm, India. The was conducted during 2020/2021 Kharif cultivation season. split-plot design adopted three replications, each consisting six treatments combinations; (T1 = control, T2 50%...