Er Meng

ORCID: 0000-0001-5027-2344
Publications
Citations
Views
---
Saved
---
About
Contact & Profiles
Research Areas
  • Ion channel regulation and function
  • Nicotinic Acetylcholine Receptors Study
  • Insect and Pesticide Research
  • Venomous Animal Envenomation and Studies
  • Antimicrobial Peptides and Activities
  • Enzyme Catalysis and Immobilization
  • Silk-based biomaterials and applications
  • Electrospun Nanofibers in Biomedical Applications
  • Monoclonal and Polyclonal Antibodies Research
  • Innovative Microfluidic and Catalytic Techniques Innovation
  • Nerve injury and regeneration
  • Plant biochemistry and biosynthesis
  • High Altitude and Hypoxia
  • Retinal Development and Disorders
  • Advanced Glycation End Products research
  • Liver physiology and pathology
  • Animal Genetics and Reproduction
  • Cancer-related gene regulation
  • Biochemical and Structural Characterization
  • Neurobiology and Insect Physiology Research
  • CRISPR and Genetic Engineering
  • Toxin Mechanisms and Immunotoxins
  • Polyamine Metabolism and Applications
  • Beetle Biology and Toxicology Studies
  • Mesenchymal stem cell research

Hunan University of Science and Technology
2019-2023

National University of Defense Technology
2011-2021

Hunan Normal University
2007-2011

Microgravity is a major environmental factor of space flight that triggers dysregulation the immune system and increases clinical risks for deep-space-exploration crews. However, systematic studies molecular mechanisms adverse effects microgravity on in animal models are limited. Here, we establish ground-based zebrafish disease model research immunology. RNA sequencing analysis demonstrates retinoic-acid-inducible gene (RIG)-I-like receptor (RLR) Toll-like (TLR) signaling pathways...

10.1016/j.celrep.2020.108600 article EN cc-by-nc-nd Cell Reports 2021-01-01

The coding sequence of huwentoxin-I, a neurotoxic peptide isolated from the venom Chinese spider Ornithoctonus huwena, was amplified by PCR using cDNA library constructed glands. cloned fragment inserted into expression vector pET-40b and transformed E. coli strain BL21 (DE3). soluble fusion protein, disulfide interchange protein (DsbC)-huwentoxin-I, auto-induced in periplasm absence IPTG. After partial purification Ni-NTA column, expressed digested enterokinase to release heteroexpressed...

10.1371/journal.pone.0021608 article EN cc-by PLoS ONE 2011-06-23

Molecular cloning methods based on primer and overlap-extension PCR are widely used due to their simplicity, reliability, low cost high efficiency. In this article, an efficient mega primer-mediated (MP) strategy for chimaeragenesis long DNA fragment insertion is presented. MP a seamless, restriction/ligation-independent method that requires only three steps: (i) the first generation; (ii) second exponential amplification mediated by primers (iii) DpnI digestion transformation. Most...

10.1042/bsr20160608 article EN Bioscience Reports 2017-02-10

Hainantoxin-IV (HNTX-IV) from the venom of spider Selenocosmia hainana is a potent antagonist that specifically inhibits tetrodotoxin-sensitive (TTX-S) sodium channels. The toxin peptide consists 35 amino acids and adopts typical inhibitory cystine knot (ICK) motif. To obtain adequate HNTX-IV peptides for further insight into structure-activity relationships toxin, novel strategy including cloning, expression purification was developed in an E. coli system. For this purpose, seamless...

10.1371/journal.pone.0117099 article EN cc-by PLoS ONE 2015-02-03

The voltage-gated sodium channel (VGSC) interacting peptide is of special interest for both basic research and pharmaceutical purposes. In this study, we established a yeast-two-hybrid based strategy to detect the interaction(s) between neurotoxic extracellular region VGSC. Using previously reported neurotoxin JZTX-III as model molecule, demonstrated that interactions regions its target hNav1.5 are detectable detected directly related activity. We further applied screening VGSC peptides....

10.1038/srep04569 article EN cc-by-nc-nd Scientific Reports 2014-04-02

In the present study, we used Escherichia coli to produce recombinant Hainantoxin-III (rHNTX-III), a 33-amino acid peptic toxin from tarantula spider Haplopelma hainanum. The has three pairs of disulfide bonds. A pET-HS-HNTX-III vector was constructed and transformed into E. strain SHuffleTM. rHNTX-III expressed using auto-induction medium. After Ni-NTA column, fusion protein digested SUMO protease (ULP1) remove HIS-SUMO tag, then RP-HPLC ultrafiltration were for further purification. Then...

10.1080/10826068.2016.1188313 article EN Preparative Biochemistry & Biotechnology 2016-06-02

Abdominal wall hernias are common abdominal diseases, and effective hernia repair is challenging. In clinical practice, synthetic meshes widely applied for repairing hernias. However, postoperative complications, such as inflammation adhesion, prevalent. Although biological can solve this problem to a certain extent, they face the problems of heterogeneity, rapid degradation rate, ordinary mechanical properties, high-cost. Here, novel electrospinning mesh composed polylactic acid silk...

10.1016/j.mtbio.2023.100915 article EN cc-by-nc-nd Materials Today Bio 2023-12-15

Spider silk is a protein fiber with the highest strength and elasticity known in nature, even higher than that of silkworm silk. It was biological technical reserve material great potential. However, low yield natural spider limits application silk, development genetic engineering provides opportunities for mass production We constructed mini-recombinant spidroin NRC based on gene fromAraneus ventricosusand successfully expressed it through Prokaryotic expression provide high using...

10.1088/1748-605x/ac2ab7 article EN Biomedical Materials 2021-09-29

Peptide drugs have received more attention as potential next-generation or drug leads. Such is primarily due to the higher target selectivities and efficiencies of peptide drugs. Moreover, typically lower accumulation rates toxicities. Although advanced significantly in 21st century, two bottlenecks (disadvantages) hinder research development compared small molecule One bottleneck identification a valuable complicated pool crude products; other ability prepare sufficient amounts peptides for...

10.2174/1570164614666161207162711 article EN Current Proteomics 2017-02-07

Numerous metabolic reactions and pathways use adenosine 5′-triphosphate (ATP) as an energy source a phosphorous or pyrophosphorous donor. Based on three-dimensional (3D)-printing, enzyme immobilization can be used to improve ATP regeneration operability reduce cost. However, due the relatively large mesh size of 3D-bioprinted hydrogels soaked in reaction solution, lower-molecular-weight enzymes cannot avoid leaking out readily. Here, chimeric adenylate-kinase-spidroin (ADK-RC) is created,...

10.1021/acs.biomac.2c01445 article EN Biomacromolecules 2023-03-13

His-tags are widely used for the purification of recombinant proteins. High-cost carriers functionalized with nickel ions commonly required selective immobilization His-tagged enzymes. In this study, varying lengths were fused to N-terminus D-amino acid oxidase (DAO) from Trigonopsis variabilis. The attachment a His6 tag significantly improved solubility DAO expressed in Escherichia coli. By modulating lengths, better balance between cell growth and protein was achieved, resulting higher...

10.3390/pr11061588 article EN Processes 2023-05-23

Jingzhaotoxin-III (JZTX-III), a 36-residue peptide cardiotoxin containing three pairs of disulphide bonds, has been characterized from the venom Chinese tarantula Chilobrachys jingzhao. JZTX-III is promising target for drug development and clinical application, due to its specific inhibitory effects on human voltage-gated potassium channel subtype hKv2.1 sodium hNav1.5, which are mainly expressed in cardiac myocytes. The most direct way obtain by extraction native jingzhao, but amount often...

10.1080/13102818.2017.1304182 article EN cc-by-nc Biotechnology & Biotechnological Equipment 2017-03-17

Due to their advantages in structural stability and versatility, cysteine-rich peptides, which are secreted from the venom glands of venomous animals, constitute a naturally occurring pharmaceutical arsenal. However, correct folding disulfide bonds is challenging task prokaryotic expression system like Escherichia coli due reducing environment. Here, secretory plasmid pSE-G1M5-SUMO-HWTX-I for spider neurotoxin huwentoxin-I (HWTX-I) with three disulfides as model peptides was constructed. By...

10.1080/10826068.2022.2158473 article EN Preparative Biochemistry & Biotechnology 2022-12-26

Age-related macular degeneration, a type of retinal degenerative disease, is the primary cause severe visual impairment and irreversible blindness in people older than 50, due to age-related deterioration photoreceptors pigment epithelium (RPE), which could be restored by cell therapy. However, success therapy depends on biocompatible scaffolds, serve as carriers for growth RPE cells repairing damaged or diseased retinas. In this study, plasmid pET-SUMO-R2C expressing mini-spidroin, fusing...

10.1080/13102818.2023.2219764 article EN cc-by-nc Biotechnology & Biotechnological Equipment 2023-03-10

The peptide toxin GsAF II (Kappa-theraphotoxin-Gr2c) is a 31-amino acid peptide, recently isolated from the venom of tarantula spider Grammostola rosea. ProTX (β/ω-theraphotoxin-Tp2a), 30-amino Thrixopelma pruriens. and have similar sequence but an impact on different activities. To find method obtaining to explore whether amino sequences affect activities or not, mutant was constructed that first two acids are tyr (Y) cys (C). YC1 as follows: YCQKWMWTCDSERKCCEGLVCRLWCKKKIEW. Then, we vector...

10.1080/23312025.2017.1317898 article EN Cogent Biology 2017-01-01

Neural stem cells (NSCs) have the ability to differentiate into neurons, astrocytes and oligodendrocytes. They are self-renewing sufficient provide large amounts of brain tissue cells. NSCs promising application prospects for treatment central nervous system diseases. Spider toxins important tools use in neurobiology neuropharmacology. In this study, a Cell Counting Kit (CCK-8), immunofluorescence staining, real-time quantitative polymerase chain reaction (RT-qPCR) Western blotting were used...

10.1080/13102818.2018.1496033 article EN cc-by Biotechnology & Biotechnological Equipment 2018-08-27
Coming Soon ...