- Antimicrobial Peptides and Activities
- Biochemical and Structural Characterization
- Immune Response and Inflammation
- Beetle Biology and Toxicology Studies
- Venomous Animal Envenomation and Studies
- Acne and Rosacea Treatments and Effects
- Protein Hydrolysis and Bioactive Peptides
- Cell Adhesion Molecules Research
- Nicotinic Acetylcholine Receptors Study
- Ion channel regulation and function
- Wound Healing and Treatments
- Herpesvirus Infections and Treatments
- Healthcare and Venom Research
- Protease and Inhibitor Mechanisms
- Neurobiology and Insect Physiology Research
- Invertebrate Immune Response Mechanisms
- Psoriasis: Treatment and Pathogenesis
- Natural product bioactivities and synthesis
- Marine Sponges and Natural Products
- Insect Utilization and Effects
- Dermatology and Skin Diseases
- Nanoplatforms for cancer theranostics
- Neuropeptides and Animal Physiology
- Dermatological and COVID-19 studies
- Medicinal Plants and Bioactive Compounds
Southern Medical University
2018-2025
Zhujiang Hospital
2021-2025
Chongqing Normal University
2025
Periplaneta americana is a common traditional Chinese medicinal material which has been used to treat arthritis, fever, aches, pains, and inflammation of the extremities for several hundred years. However, little scientific data exists in literature support its use. The purpose this study was evaluate antipyretic, anti-inflammatory analgesic activities extract (PAE) explore underlying mechanism. were evaluated by LPS-induced carrageenan-induced paw edema, abdominal writhing, hot plate...
Protease inhibitors regulate various biological processes and prevent host tissue/organ damage. Specific inhibition/regulation of proteases is clinically valuable for treating several diseases. Psoriasis affects the skin in limbs scalp body, contribution cysteine serine to development inflammation well documented. Cysteine protease from ticks have high specificity, selectivity, affinity their target are efficient immunomodulators. However, potential therapeutic effect on psoriasis...
Antimicrobial peptides (AMPs) are key components of host immune defense vertebrates against microbial invasions. Here, we report a new AMP (esculentin-1GN) characterized from the skin frog Hylarana guentheri. Esculentin-1GN (GLFSKKGGKGGKSWIKGVFKGIKGIGKEVGGDVIRTGIEIAACKIKGEC) with high amphipathic α-helical structure in membrane-mimetic environments has microbial-killing activity by destruction cell membrane. Moreover, esculentin-1GN inhibits LPS-induced expression proinflammatory nitric...
Smp24, a cationic antimicrobial peptide identified from the venom gland of Egyptian scorpion Scorpio maurus palmatus, shows variable cytotoxicity on various tumor (KG1a, CCRF-CEM and HepG2) non-tumor (CD34+, HRECs, HACAT) cell lines. However, effects Smp24 its mode action lung cancer lines remain unknown. Herein, effect viability, membrane disruption, cytoskeleton, migration invasion, MMP-2/-9 TIMP-1/-2 expression human cells have been evaluated. In addition, in vivo antitumor role acute...
Platelet activation contributes to sepsis development, leading microthrombosis and increased inflammation, which results in disseminated intravascular coagulation multiple organ dysfunction. Although Cathelicidin can alleviate sepsis, its role regulation remains largely unexplored. In this study, we identified Cath-HG, a novel from Hylarana guentheri skin, analyzed structure using nuclear magnetic resonance spectroscopy. The modulatory effect of Cath-HG on the symptoms mice with induced by...
Antimicrobial peptides form part of the innate immune response and play a vital role in host defense against pathogens. Here we report new antimicrobial peptide belonging to cathelicidin family, cathelicidin-MH (cath-MH), from skin Microhyla heymonsivogt frog. Cath-MH has single α-helical structure membrane-mimetic environments is fungi bacteria, especially Gram-negative bacteria. In contrast other cathelicidins, cath-MH suppresses coagulation by affecting enzymatic activities tissue...
Scorpion-venom-derived peptides have become a promising anticancer agent due to their cytotoxicity against tumor cells via multiple mechanisms. The suppressive effect of the cationic antimicrobial peptide Smp24, which is derived from venom ScorpioMaurus palmatus, on proliferation hepatoma cell line HepG2 has been reported earlier. However, its mode action remains unclear. In current research, Smp24 was discovered suppress viability while having minor normal LO2 cells. Moreover, endocytosis...
Antimicrobial peptide is one important component of the first protective barrier organisms. They not only have potent antimicrobial activity which can protect body from invading pathogens, but also participate in immune regulation body. In this study, a Brevinin-1 named by Brevinin-1GHd was identified Hoplobatrachus rugulosus , and similarity mature sequence among Brevinin-1GHd, Brevinin-1HL Brevinin-1GHa supported close species relationship between H. Hylarana latouchii guertheri ....
Smp43, a cationic antimicrobial peptide identified from the venom gland of Egyptian scorpion Scorpio maurus palmatus, shows cytotoxicity toward hepatoma cell line HepG2 by membrane disruption. However, its underlying detailed mechanisms still remain to be further clarified. In present study, we evaluated cellular internalization Smp43 and explored effects on viability, cycle, apoptosis, autophagy, necrosis, factor expression related these processes in human HepG2. was found suppress growth...
Parkinson's disease (PD) is a neurodegenerative condition that results in dyskinesia, with oxidative stress playing pivotal role its progression. Antioxidant peptides may thus present therapeutic potential for PD. In this study, novel cathelicidin peptide (Cath-KP; GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV) was identified from the skin of Asiatic painted frog (
Problematic Social Media Use (PSMU) refers to an individual's long-term, high-intensity use of social media. Although this behavior is not pathological, it has a negative impact on the physical and mental health individuals. In past, intervention methods used for PSMU often controlled reduce usage time individual media platforms. However, because psychological needs satisfaction unreasonable cognition that lead problematic by individuals are considered, behavior-based treatment models do...
Non-small cell lung cancer (NSCLC) is the leading cause of death in due to its aggressiveness and rapid migration. The potent antitumor effect Smp24, an antimicrobial peptide derived from Egyptian scorpion Scorpio maurus palmatus via damaging membrane cytoskeleton have been reported earlier. However, effects on mitochondrial functions ROS accumulation human cells remain unknown. In current study, we discovered that Smp24 can interact with be internalized into A549 endocytosis, followed by...
Three-dimensional (3D) and two-dimensional (2D) Ag-based zwitterionic metal-organic frameworks (MOFs) [Ag2(Cedcp)]n (1, 3D, H3CedcpBr denotes N-(carboxyethyl)-(3,5-dicarboxyl)-pyridinium bromide) {[Ag4(Cmdcp)2(H2O)4]·4H2O}n (2, 2D, H3CmdcpBr N-(carboxymethyl)-(3,5-dicarboxyl)-pyridinium have been prepared investigated for antimicrobial activity via minimal inhibition concentration (MIC) test killing kinetic assay. Both MOFs 1 2 show good water stability solubility ascribed to their...
Acne vulgaris is a common adolescent skin condition which mainly caused by Propionibacterium acnes overcolonization and subsequent inflammation. Our previous studies have demonstrated that Cath-MH, an antimicrobial peptide from the of frog Microhyla heymonsivogt , possesses potential antimicrobial, LPS-binding, anti-septicemic properties. However, its protective effects mechanisms against acne are still unclear. In present study, anti- P. were measured two-fold broth dilution method,...
Research has been conducted to investigate the potential application of scorpion venom-derived peptides in cancer therapy. Smp43, a cationic antimicrobial peptide from Scorpio maurus palmatus venom, found exhibit suppressive activity against proliferation multiple cell lines. However, its impact on non-small-cell lung (NSCLC) lines not previously investigated. This study aimed determine cytotoxicity Smp43 towards various NSCLC lines, particularly A549 cells with an IC50 value 2.58 μM. The...
The voltage-gated potassium (Kv) 1.3 channel plays a crucial role in the immune responsiveness of T-lymphocytes and macrophages, presenting potential target for treatment immune- inflammation related-diseases. FS48, protein from rodent flea Xenopsylla cheopis, shares three disulfide bond feature scorpion toxins. However, its three-dimensional structure biological function are still unclear. In present study, FS48 was evaluated by circular dichroism homology modeling. We also described vitro...
Several years have passed since the Zika virus (ZIKV) pandemic reoccurred in 2015-2016. However, there is still a lack of proved protective vaccines or effective drugs against ZIKV. The peptide brevinin-2GHk (BR2GK), pertaining to brevinin-2 family antimicrobial peptides, has been reported exhibit only weak antibacterial activity, and its antiviral effects not investigated. Thus, we analyzed effect BR2GK on ZIKV infection. showed significant inhibitory activity early middle stages infection,...
Sepsis is an exacerbated inflammatory reaction induced by severe infection. As important defensive molecules in innate immunity, several AMPs are reported to prevent septic shock. In this study, we characterized a novel cathelicidin, FM-CATH, from the frog skin of F. multistriata. FM-CATH was found adopt amphipathic α-helix structural membrane-mimetic environments and possess favorable antimicrobial effects against bacteria fungus. addition, it triggered agglutination bacteria. It could also...