A5101866869- Fungal Infections and Studies
- Antifungal resistance and susceptibility
- Cervical Cancer and HPV Research
- Invertebrate Immune Response Mechanisms
- Acne and Rosacea Treatments and Effects
- Antimicrobial Peptides and Activities
- Studies on Chitinases and Chitosanases
- Wound Healing and Treatments
- Nail Diseases and Treatments
- Dermatology and Skin Diseases
- Autoimmune Bullous Skin Diseases
- Folate and B Vitamins Research
- Psoriasis: Treatment and Pathogenesis
- Plant Pathogens and Fungal Diseases
- Nonmelanoma Skin Cancer Studies
- Viral-associated cancers and disorders
- Urticaria and Related Conditions
- Liver Disease and Transplantation
- Herpesvirus Infections and Treatments
- Immunodeficiency and Autoimmune Disorders
- Mesenchymal stem cell research
- Cutaneous lymphoproliferative disorders research
- Genetics, Aging, and Longevity in Model Organisms
- Photodynamic Therapy Research Studies
- Nanoparticles: synthesis and applications
Nanfang Hospital
2017-2025
Southern Medical University
2017-2025
University of Hong Kong
2025
PLA Academy of Military Science
2022-2024
Chinese PLA General Hospital
2024
Ocean University of China
2021-2024
Zhejiang Ocean University
2023
First Affiliated Hospital of Henan University
2023
Zhengzhou University
2019-2022
Guangdong University Of Finances and Economics
2022
An efficient use of energy is the pre-condition for economic development. But excessive fossil fuel harms environment. As renewable emits no or low greenhouse gases, more countries are trying to increase energies from sources. At same time, matter developed developing, nations have maintain growth. By collecting SCI/SSCI indexed peer-reviewed journal articles, this article systematically reviews consumption nexus and A total 46 articles been reviewed following PRISMA guidelines 2010 2021....
Significance There is a critical lack of therapeutic agents to treat infections caused by nongrowing persister forms methicillin-resistant Staphylococcus aureus (MRSA). Although membrane-disrupting can kill cells, their potential has been mostly overlooked because low selectivity for bacterial versus mammalian membranes. We report that the clinically approved anthelmintic drug bithionol kills MRSA persisters disrupting membrane lipid bilayers at concentrations exhibit levels toxicity cells....
This paper measures the green energy consumption levels of 30 provinces and 221 cities in China from 2009 to 2019 by using entropy method comprehensive evaluation model. The natural breakpoint is applied divide data into three intervals corresponding low-level interval, medium level high-level interval explore spatial distribution pattern levels. Secondly, a difference-in-difference model built assess effect establishment new demonstration on significantly contributed improving consumption,...
Abstract Triggering receptor expressed on myeloid cells 2 ( TREM ‐2) is a cell surface abundantly lineage such as macrophages and dendritic cells. It reported that ‐2 functions an inflammatory inhibitor in However, the role of bacterial killing remains unclear. This study explored eradication Pseudomonas aeruginosa PA ), Gram‐negative bacterium which causes various opportunistic infections. Phagocytosis assay assessed by flow cytometry suggested TREM‐2 was not involved uptake macrophages,...
Purpose: Zinc oxide nanoparticles (ZnO-NPs) have exerted antimicrobial properties. However, there is insufficient evaluation regarding the in vivo antifungal activity of ZnO-NPs. This study aimed to investigate efficacy and mechanism ZnO-NPs controlling Candida albicans invertebrate Galleria mellonella. Methods:Galleria mellonella larvae were injected with different doses determine their toxicity. Non-toxic chosen for prophylactic injection G. followed by C. infection. Then direct vitro...
Abstract Human papillomavirus (HPV) infection poses a significant threat to public health worldwide. Targeting the function of HPV E6 and E7 proteins activating host immune response against these represent promising therapeutic strategies for combating HPV-related diseases. Consequently, efficient production soluble, high-purity is crucial studies. In this context, we selected pMCSG19 protein expression vector Escherichia coli produce soluble MBP-His 6 tagged HPV11/16 E6/E7 proteins,...
Penicillium marneffei, one of the most important thermal dimorphic fungi, is a severe threat to life immunocompromised patients. However, pathogenic mechanisms P. marneffei remain largely unknown. In this work, we developed model host by using nematode Caenorhabditis elegans investigate virulence marneffei. Using two clinical isolate strains 570 and 486, revealed that in both liquid solid media, ingestion live was lethal C. (P<0.001). Meanwhile, our results showed strain 570, which can...
Osthole is a natural coumarin that exhibits wide biological and pharmacological activities such as neuroprotective, osteogenic, immunomodulation, antitumor, anti-inflammatory effects. In this study, we investigated the antifungal effects of osthole in vitro A checkerboard microdilution assay showed has significant synergistic effect with fluconazole against fluconazole-resistant Candida albicans Similar results were obtained from growth curve assay. Meanwhile, XTT reduction demonstrated...
Sporothrix globosa is a thermo-dimorphic fungus belonging to pathogenic clade that also includes schenckii, which causes human and animal sporotrichosis. Here, we present the first genome assemblies of two S. strains providing data for future comparative genomic studies in species.
Evidence from previous epidemiological studies on the effect of physical activity risk Alzheimer's disease (AD) is conflicting. We performed a two-sample Mendelian randomization analysis to verify whether causally associated with AD. This study used (MR) estimate association between (including overall activity, sedentary behavior, walking, and moderate-intensity activity) Genetic instruments for were obtained published genome-wide (GWAS) including 91,105 individuals UK Biobank. Summary-level...
Abstract Dysregulation of adipose tissue (AT) homeostasis in obesity contributes to metabolic stress and disorders. Here, we identified that Coiled‐coil‐helix‐coiled‐coil‐helix domain containing 10 (Chchd10) is a novel regulator AT remodeling upon excess energy intake. Chchd10 significantly reduced the white (WAT) mice response high‐fat diet (HFD) feeding. AT‐Chchd10 deficiency accelerates adipogenesis predominantly subcutaneous store short‐term HFD feeding while upregulates glutathione...
Lipolysis in white adipose tissue (WAT) provides fatty acids as energy substrates for thermogenesis to increase expenditure. Syndecan-4 (Sdc4) is a transmembrane proteoglycan bearing heparan sulfate chains. Although single nucleotide polymorphisms (SNPs) of the Sdc4 gene have been identified linking metabolic syndromes, its specific function remains obscure. Here, we show that serves regulator lipid metabolism and adaptive thermogenesis. expression shedding are elevated WAT diet-induced...
Summary P enicillium marneffei , a dimorphic fungus that can cause penicilliosis marneffei, is endemic in Southeast Asia. The only known hosts of . are humans and bamboo rats. aim our study was to explore the distribution rats, their associated environment non‐rat‐associated environments. Totally, 270 samples were collected Guangdong province C hina 2012; prevalence much higher from surrounding areas burrows (8.2%) than obtained sites (2%) or artificial farms rats (0%). There no difference...
Parkinson's disease (PD) is a neurodegenerative condition that results in dyskinesia, with oxidative stress playing pivotal role its progression. Antioxidant peptides may thus present therapeutic potential for PD. In this study, novel cathelicidin peptide (Cath-KP; GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV) was identified from the skin of Asiatic painted frog (
Abstract Background New therapeutics are urgently needed for infectious diseases, especially the fungal infection like Fonsecaea monophora . Photodynamic therapy has been showing antimicrobial activity on some pathogens. The combination of medicines and photodynamic (PDT) might be a practical approach. However, whether treatment PDT could do benefits to host immunity remains poorly documented. Results In this study, Galleria mellonella larvae were employed as model organism evaluate PDT,...