The timing of the developmental transition to flowering is critical reproductive success in plants. Here, we show that Arabidopsis thaliana homologs human Lysine-Specific Demethylase1 (LSD1; a histone H3-Lys 4 demethylase) reduce levels methylation chromatin floral repressor FLOWERING LOCUS C (FLC) and sporophytically silenced FWA. Two homologs, LSD1-LIKE1 (LDL1) LSD1-LIKE2 (LDL2), act partial redundancy with D (FLD; an additional homolog LSD1) repress FLC expression. However, LDL1 LDL2...

Abstract Exposure to short‐term cold stress influences disease resistance by mechanisms that remain poorly characterized. The molecular basis of cold‐activated immunity was therefore investigated in Arabidopsis thaliana inoculated with the bacterial pathogen Pst DC3000, using a transcriptomic analysis. for 10 hr sufficient activate immunity, as well H 2 O accumulation and callose deposition. Transcriptome changes induced 10‐hr treatment were similar those caused infection, including...

Histone demethylation regulates chromatin structure and gene expression, is catalyzed by various histone demethylases. Trimethylation of H3 at lysine 4 (H3K4) coupled to active expression; trimethyl H3K4 demethylated Jumonj C (JmjC) domain-containing demethylases in mammals. Here we report that a plant-specific JmjC protein known as PKDM7B (At4g20400) demethylates H3K4. mediates key floral promoter, FLOWERING LOCUS T (FT), an FT homolog, TWIN SISTER OF (TSF), represses their expression...

RNA molecules such as small-interfering RNAs (siRNAs) and antisense (asRNAs) trigger chromatin silencing of target loci. In the model plant Arabidopsis, RNA–triggered involves repressive histone modifications deacetylation, H3 lysine-9 methylation, lysine-27 monomethylation. Here, we report that two Arabidopsis homologs human histone-binding proteins Retinoblastoma-Associated Protein 46/48 (RbAp46/48), known MSI4 (or FVE) MSI5, function in partial redundancy various loci targeted by siRNAs...

Hexoses are important metabolic signals that respond to abiotic and biotic stresses. Cold stress adversely affects plant growth development, limiting productivity. The mechanism by which sugars regulate cold tolerance remains elusive. We examined the function of INVINH1, a cell wall invertase inhibitor, in tomato chilling tolerance. suppressed transcription INVINH1 increased genes, Lin6 Lin8 seedlings. Silencing expression activity enhanced Conversely, transgenic tomatoes over-expressing...

Plant defence mechanisms are suppressed in the absence of pathogen attack to prevent wasted energy and growth inhibition. However, how responses repressed is not well understood. Histone deacetylase 6 (HDA6) a negative regulator gene expression, its role response plants known. In this study, novel allele hda6 (designated as shi5) with spontaneous was isolated from forward genetics screening Arabidopsis. The shi5 mutant exhibited increased resistance hemibiotrophic bacterial Pst DC3000,...

U2AF65B is one of the splicing factors that are involved in recognition 3' site and it plays an important role plant development stress response through its mRNA function. However, not clear whether regulates gene expression a splicing-independent manner. Through mutant screening map-based cloning, protein-protein interaction, transcriptomic sequencing, whole-genome bisulfite sequencing chromatin immunoprecipitation analysis, we investigated function silencing Arabidopsis thaliana. We found...

Polyamines involve in gene regulation by interacting with and modulating the functions of various anionic macromolecules such as DNA, RNA proteins. In this study, we identified an important function polyamine transporter LHR1 (LOWER EXPRESSION OF HEAT RESPONSIVE GENE1) heat-inducible expression Arabidopsis thaliana. The lhr1 mutant was isolated through a forward genetic screening for altered luciferase reporter driven promoter from AtHSP18.2. showed reduced induction response to heat stress...

Abstract Abiotic stresses greatly affect the immunity of plants. However, it is unknown whether pathogen infection affects abiotic stress tolerance host Here, effect defense response on cold and heat plants was investigated in Pst DC3000‐infected Arabidopsis plants, found that pathogen‐induced could alleviate injury caused by subsequent (38°C). Transcriptomic sequencing plus RT‐qPCR analyses showed some genes are up‐regulated transcription infection, including signaling components ICE1 ,...

As a common adverse environmental factor, heat stress (HS) not only drastically changes the plant transcriptome at transcription level but also increases alternative splicing (AS), especially intron retention (IR) events. However, exact mechanisms are yet well understood. Here, we reported that NTC-related protein 1 (NTR1), which acts as an accessory component for spliceosome disassembly, is necessary this process. The mutants of NTR1, both T-DNA insertion and point mutation identified...

Flowering at an appropriate time is crucial for seed maturity and reproductive success in all flowering plants. Soybean (Glycine max) a typical short day plant, both photoperiod autonomous pathway genes exist soybean genome. However, little known about the functions of genes. In this article, we examined homolog gene FLOWERING LOCUS D (FLD), GmFLD transition A. thaliana. soybean, highly expressed expanded cotyledons seedlings, roots, young pods. expression levels are low leaves shoot apexes....

Gene regulation is central for growth, development, and adaptation to environmental changes in all living organisms. Many genes are induced by cues, the expression of these inducible often repressed under normal conditions. Here, we show that SHINY2 (SHI2) gene important repressing salt-inducible also plays a role cold response. The shi2 mutant displayed hypersensitivity cold, abscisic acid (ABA), LiCl. Map-based cloning demonstrates SHI2 encodes DEAD- (Asp-Glu-Ala-Asp) box RNA helicase with...

Abstract Salicylic acid (SA) plays an important role for plant immunity, especially resistance against biotrophic pathogens. SA quickly accumulates after pathogen attack to activate downstream immunity events and is normally associated with a tradeoff in growth. Therefore, the level plants has be strictly controlled when pathogens are absent, but how this occurs not well understood. Previously we found that Arabidopsis (Arabidopsis thaliana), HISTONE DEACETYLASE 6 (HDA6), negative regulator...

Vol. 270, p. 14184 Page 14187, Fig. 2: We have uncovered three errors in the DNA sequence of p96 reported 2. The are: 1) deletion a T at position 1700, 2) insertion G between positions 1608 and 1609, 3) 2512. These corrections change predicted coding amino acid residues 465 495 to read GQMSPTGQPAVPQSNFLDLFKGNAPPPVGPL predict smaller protein product 766 acids. sequencing do not impact on main conclusions paper. changes been recorded GenBank™ database, accession number U18869. thank Hans...

Abstract Seed germination, the first and critical step of plant's life cycle, is affected by salt stress. However, underlying mechanism tolerance during early seed germination remains elusive. Here, a comparative RNA-seq analysis was performed using germinating seeds either under normal conditions or in 100 150 mM sodium chloride. A total 575 genes were up-regulated 913 down-regulated presence NaCl. Under NaCl treatment 1921 3501 down-regulated. 379 863 both 150mM These co-regulated further...

Gleditsia sinensis is a Chinese native deciduous tree with high economic and medicinal value.However, there limited knowledge on the molecular processes responsible for medical properties of this species owing to lack bioinformatic resources such as available wholegenome sequences.In present study, RNA sequencing data were used analyze transcriptome G. sinensis, series tools was explore main genes involved in important processes.A total 75.57 million paired-end reads, length 101 bp, acquired...

Dipacus asperoides (DA), a traditional perennial herb, has distributed wildly in China, especially Wuhe Xuduan known as genuine herb. To evaluate DA's quality, we collected ten samples from eight counties Enshi and determined the contents of total saponins (TS) asperosaponin VI (Asp. VI) using vanillin - glacial acetic acid perchloric with spectrophotometry ultra-high performance liquid chromatography (UPLC) separately. Subsequently, carried out optimization extraction TS, Asp. several...

Polyamines (PAs) are polycationic compounds found in all living organisms and play crucial roles growth survival. PAs interact with modulate the functions of anionic macromolecules such as DNA, RNA proteins. LHR1/PUT3 is a polyamine influx transporter localized plasma membrane Arabidopsis. In our recent paper The Plant Journal, 1 we demonstrated that has pivotal role stabilizing mRNAs several important heat stress responsive genes under high temperature. this short communication, discuss...

Payenapara lleloneura Kurz. (Kan-zaw), an endemic medicinal plant only found in Tanintharyi Region of Myanmar, is widely used the treatment various cancer and different ailments. In present research, seeds were phytochemical investigated for their nutritional potential use as functional foods or novel diet oil resources. Nutritional evaluation showed that are rich fats carbohydrates (soluble sugars starch). Fatty acid analyses accumulate very α-eleostearic (α-ESA, 18:3Δ9cis,11trans,13trans),...

Abstract Pathogen infection cross-activates cold response and increase tolerance of host plants. However it is not possible to use the field Here flagellin 22 (flg22), most widely-studied PAMP, was used mimic pathogen cross-activate response. Flg22 treatment alleviated injury caused by freezing in Arabidopsis, oilseed tobacco. In flg22 activated expression immunity cold-related genes. Moreover induced alleviation lost NahG transgenic line (SA-deficient), sid2-2 npr1-1 mutant plants,...