Xia Xiong

ORCID: 0000-0003-0448-9491
Publications
Citations
Views
---
Saved
---
About
Contact & Profiles
Research Areas
  • Cancer-related molecular mechanisms research
  • Animal Nutrition and Physiology
  • MicroRNA in disease regulation
  • Circular RNAs in diseases
  • Venomous Animal Envenomation and Studies
  • Antimicrobial Peptides and Activities
  • Genetic and phenotypic traits in livestock
  • Ion channel regulation and function
  • Silk-based biomaterials and applications
  • Ruminant Nutrition and Digestive Physiology
  • Aquaculture Nutrition and Growth
  • Mass Spectrometry Techniques and Applications
  • Nicotinic Acetylcholine Receptors Study
  • Dermatologic Treatments and Research
  • Laser Applications in Dentistry and Medicine
  • RNA Research and Splicing
  • Metabolomics and Mass Spectrometry Studies
  • Lipid Membrane Structure and Behavior
  • Genetic Mapping and Diversity in Plants and Animals
  • High Altitude and Hypoxia
  • Tendon Structure and Treatment
  • Biochemical effects in animals
  • Moringa oleifera research and applications
  • Phosphodiesterase function and regulation
  • Livestock and Poultry Management

Sichuan Animal Science Academy
2018-2024

Nanjing University of Chinese Medicine
2023

Affiliated Hospital of Southwest Medical University
2023

University of California, Davis
2019-2020

Poultry Research Institute
2020

Southwest University
2019

Hunan Normal University
2004-2009

There is growing evidence to support the beneficial effects of supplementing direct-fed microbials (DFM) on performance, health status, and immune responses weaned pigs. Therefore, objective this study was investigate dietary supplementation Bacillus subtilis (DSM 25841) growth diarrhea, gut permeability immunity pigs experimentally infected with a pathogenic F-18 Escherichia coli (E. coli). The F18 E. infection reduced (P < 0.05) performance intestinal villi height, whereas increased...

10.1186/s40104-019-0364-3 article EN cc-by Journal of Animal Science and Biotechnology/Journal of animal science and biotechnology 2019-06-25

Objective: The goal of this study was to investigate the mechanisms muscle growth and development three chicken breeds. Participants: Eighteen chickens, including different breeds with speeds (White Broiler, Daheng, Commercial Layers Roman), were used. Methods: Total RNA from breast these chickens subjected a gene expression microarray. Differentially expressed genes (DEGs) screened functional enrichment analysis performed using DAVID. Seven DEGs confirmed by quantitative reverse...

10.1080/10495398.2018.1476377 article EN Animal Biotechnology 2019-01-02

Hainantoxin-IV (HNTX-IV) can specifically inhibit the neuronal tetrodotoxin-sensitive sodium channels and defines a new class of depressant spider toxin. The sequence native HNTX-IV is ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2. In present study, to obtain further insight into primary tertiary structural requirements channel blockers, we determined solution structure as typical inhibitor cystine knot motif synthesized four mutants designed based on predicted sites followed by elucidation two...

10.1074/jbc.m405765200 article EN cc-by Journal of Biological Chemistry 2004-06-17

Abstract Background Dorsal root ganglion (DRG) neurons are primary sensory that conduct neuronal impulses related to pain, touch and temperature senses. Plasma membrane (PM) of DRG cells plays important roles in their functions. PM proteins main performers the However, mainly due very low amount leads difficulties sample collection, few proteomic analyses on have been reported it is a subject demands further investigation. Results By using aqueous polymer two-phase partition combination with...

10.1186/1477-5956-7-41 article EN cc-by Proteome Science 2009-11-05

Background Tibetan chickens living at high altitudes show specific adaptations to high-altitude conditions, but the epigenetic modifications associated with these have not been characterized. Results We investigated genome-wide DNA methylation patterns in chicken blood by using whole genome bisulfite sequencing. Generally, exhibited analogous that of lowland chickens. A total 3.92% genomic cytosines were methylcytosines and 51.22% CG contexts methylated, which was less than those (55.69%)....

10.1371/journal.pone.0193597 article EN cc-by PLoS ONE 2018-03-21

Broodiness, a maternal behavior, is accompanied by the atresia of follicles and serious degradation poultry reproductive performance. The comparison between brooding laying hens usually an ideal model for exploring regulation mechanism follicle atresia. In this study, we selected three to collect their whole transcriptome sequencing. results demonstrated different expression patterns hens. top 10 differentially expressed genes with highest expression, MMP10 was relatively low in hens, but...

10.1080/10495398.2022.2136680 article EN Animal Biotechnology 2022-10-28

As a ubiquitous heavy metal, cadmium (Cd) is highly toxic to various organs. However, the effects and molecular mechanism of Cd toxicity in chicken heart remain largely unknown. The goal our study was investigate cardiac injury chickens' exposure Cd. We detected levels oxidative stress–related molecules Cd-induced heart, assessed histopathological changes by hematoxylin eosin staining. RNA sequencing performed identify differentially expressed mRNAs between group control group. expression...

10.1016/j.psj.2020.12.029 article EN cc-by-nc-nd Poultry Science 2021-01-23

This study was conducted to evaluate the effects of stocking density on productive performance, egg quality, and antioxidant capacity in laying ducks. A total 720 20-week-old Jinding ducks were randomly assigned 5 densities (4, 5, 6, 7, 8 birds/m2) with replicate pens each treatment. The results showed that increasing linearly increased production mass decreased FCR (P < 0.05). eggshell strength thickness 0.05) quadratically an increase density. Increased concentrations estradiol-17β...

10.1080/09712119.2020.1824919 article EN cc-by-nc Journal of Applied Animal Research 2020-01-01

The blue-shelled egg not only plays a key role in helping birds to avoid predation as result of crypsis and mimetism, but it also provides eggshell strength filters solar radiation; moreover, has an important economic trait for poultry. However, the source biliverdin remains unsolved ducks. current study detected content localization heme oxygenase 1 (HMOX1) duck shell gland; RNA-seq analysis was performed gland white-shelled Results indicated that is primary pigment ducks, HMOX1 protein...

10.3382/ps/pey576 article EN cc-by-nc-nd Poultry Science 2019-01-09

Previous studies have shown that the feather growth rate of chicks is determined by two alleles located on sex chromosome Z; however, in chicken production, feathering usually not consistently controlled chromosome. To identify whether related to autosomal inheritance, whole-genome resequencing was performed eight chickens with slow- and fast-feathering rate. A total 54,984 single nucleotide polymorphisms (SNPs) were identified, including 393 376 exonic SNPs slow-feathering chickens,...

10.1080/10495398.2020.1846545 article EN Animal Biotechnology 2020-12-21

Abstract Sichuan mountainous black‐bone (SMB) chicken is a small‐sized black‐feathered breed with low amount of meat, while Dahen (DH) has larger body size and faster growth rate. MicroRNAs (miRNAs) are involved in various physiological processes, but their role muscle remains unclear. We aimed to investigate the miRNAs pathways participating chicken. MiRNA profiles four SMB chickens DH were detected by small RNA sequencing. A total 994 known identified, among which gga‐miR‐1a‐3p,...

10.1111/jpn.13312 article EN Journal of Animal Physiology and Animal Nutrition 2020-01-20

Granulosa cell (GC) apoptosis is the main trigger of follicular atresia. MicroRNAs (miRNAs) are 18-22 nt RNAs whose function primarily determined by their extended seed region and considered to be involved in biological functions development, including atresia, folliculogenesis, oogenesis. MiR-138-5p known act on chicken GCs. In this study, we found that miR-138-5p was enriched reproductive organs, such as uterus ovaries. To examine whether could regulate process GCs, examined transfection...

10.1080/10495398.2022.2095642 article EN Animal Biotechnology 2022-07-06

Abstract Background Long non-coding RNAs (lncRNAs) play an essential role in biological processes. However, the expression patterns of lncRNAs that regulate non-Mendelian inheritance feather phenotypes remain unknown. Objective This study aimed to compare profiles follicles late-feathering cocks (LC) and hens (LH) followed genetic rules early-feathering hen (EH) cock (EC) did not conform laws. Methods We performed RNA sequencing investigated differentially expressed (DElncRNAs) between...

10.1007/s13258-022-01304-2 article EN cc-by Genes & Genomics 2022-09-10

MicroRNAs (miRNAs) exist widely and are involved in multiple biological processes ducks, whereas the regulatory mechanism of miRNAs egg laying ducks has remained unclear. This study aims to reveal key regulation production duck ovaries.High-throughput sequencing was performed on four egg-type ovaries egg-meat-type at start egg-laying stage. Quantitative reverse transcription PCR (qRT-PCR) validation differentially expressed (DE miRNAs). Gene network DEmiRNA-mRNA-pathway constructed by...

10.7717/peerj.8440 article EN cc-by PeerJ 2020-02-04

1. The Tibetan chicken, which is an indigenous breed living on the Plateau, exhibits hypoxic adaptations to its high-altitude environment. However, molecular mechanism behind this adaptation still unclear. This study aimed investigate differentially expressed miRNAs involved in through high-throughput RNA sequencing.2. Quantitative reverse transcription polymerase chain reaction (qRT-PCR) was used verify and their target genes chicken embryonic heart tissues fibroblasts. Luciferase reporter...

10.1080/00071668.2020.1792835 article EN British Poultry Science 2020-07-07
Coming Soon ...